PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2645s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 402aa    MW: 45083 Da    PI: 7.7037
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2645s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.7e-52191461128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             + pGfrFhPtdeelv +yL++k+e+++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg
  SapurV1A.2645s0010.1.p  19 MLPGFRFHPTDEELVGFYLRRKIEQRSLPI-ELIKQVDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATG 104
                             579***************************.89***************8888999******************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +d++++s+  ++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  SapurV1A.2645s0010.1.p 105 TDRPIYSSdCTRCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 146
                             *******867778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5718177IPR003441NAC domain
PROSITE profilePS5100556.27219177IPR003441NAC domain
PfamPF023652.6E-2521146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MRRRKMEDKN DVDKIDDVML PGFRFHPTDE ELVGFYLRRK IEQRSLPIEL IKQVDIYKYD  60
PWDLPKLATT GEKEWYFYCP RDRKYRNSAR PNRVTGAGFW KATGTDRPIY SSDCTRCIGL  120
KKSLVFYRGR AAKGIKTDWM MHEFRLPSLA EPSPPKKPLD KTLPANDAWA ICRIFKKTNS  180
MAQRALSHSW VSPILPETAA SDWAHCTQFS SENMSCTTEI GSNFHLGSNN DFQQASPASL  240
SVLDIPSYKP MINPIAHTSY LFPVSNGDLP NNFLFSPLEI SCPVKSTDDA PSMLFNPSMM  300
GEAGKTSGSI EYEGSQQQFN GFSINLLQEM QGNIGAGDET GLRKDPSSIQ DNNLLGTLRS  360
IGFPFSLPSN LPGAWNSNLP WDSPSCPSEM STTYSTNKCH P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-522118017171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010603.10.0PREDICTED: protein FEZ-like isoform X2
TrEMBLB9IJW70.0B9IJW7_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-107NAC domain containing protein 94